PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009604550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 693aa    MW: 77390.6 Da    PI: 4.4595
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009604550.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.55.6e-4941311128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd el+++yLk+k+ gkkl++ e+i+e++iyk+ PwdLp k ++k+++ ewyfF++r++kya+g r nrat++gyWk+tgkd+++ 
  XP_009604550.1   4 LPPGFRFHPTDVELIMYYLKRKIMGKKLHF-EAITELNIYKFSPWDLPdKcCYKSKDLEWYFFCPRERKYASGARMNRATETGYWKTTGKDRSIN 97 
                     79**************************99.89***************6545666777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++ vg  ktLvf++g+ p+g++tdWv+hey++
  XP_009604550.1  98 Y-DEKIVGSVKTLVFHQGHPPRGQRTDWVIHEYKF 131
                     9.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-582154IPR003441NAC domain
PROSITE profilePS5100554.8314154IPR003441NAC domain
PfamPF023651.7E-245130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    Send to blast
MARLPPGFRF HPTDVELIMY YLKRKIMGKK LHFEAITELN IYKFSPWDLP DKCCYKSKDL  60
EWYFFCPRER KYASGARMNR ATETGYWKTT GKDRSINYDE KIVGSVKTLV FHQGHPPRGQ  120
RTDWVIHEYK FEDKGLADAG FAQDSYVLCK VFQKSGPGPK NGAQYGAPFK EADWEDDEIP  180
AEPCTSDVLC APPRRPDNKN YSIESEASMV NPGSTSGLPS SQPSPSLSSI QRMPLDEPNI  240
EVLGEPHPSN VSPINWMPSD KLDDEGVTGE SNPSNIFSAL PVLPEKQSLI DTSMINRGPG  300
PSNALLCTNK MPLDEQDDEI IGLLAHFTED TTLLSDGNEN NQNLENFNQD MNALPDPFTD  360
GNDIFDGLGN IENWEGLGQS RSDLSASWRA NYSLNPMILP EDAAYMELND LEIPLDHSAG  420
TFETGRLALS NFCVPYKSNI DVQQFCFGNN SLGINQDFCE NQLPMLPESY TQQVNHSDMV  480
YNYYQNNVSQ GYNAATNFSV SSYKQPEENS RLAAQNMERG VQQRKFYLSI FAICGGSLIL  540
VKAEVILGID GCTNDALSVI LGDLFYSSIF ALCGGSFIFV KAEVTLEIDG CTDEALSVIL  600
GGLSCVFTCQ SNVGKADISK EVLEPLRFGF SLALCFSHLK KLWCNLFWEF YEFIFLKILL  660
NQLQVIIQVV CCFIFIPILA ISLLCGALGL ITH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-45415415168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604550.10.0PREDICTED: uncharacterized protein LOC104099302
RefseqXP_009604551.10.0PREDICTED: uncharacterized protein LOC104099302
TrEMBLK4D4K50.0K4D4K5_SOLLC; Uncharacterized protein
STRINGSolyc11g005920.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60502334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.18e-83NAC domain containing protein 103